PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc08768.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 222aa    MW: 23959 Da    PI: 4.4832
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc08768.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.8e-091965445
                                    S-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  4 WTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                                    WT e ++ + +av+    +      +W++Ia+ +  g+t+++++ ++ 
  Zmw_sc08768.1.g00010.1.sm.mkhc 19 WTREQEKAFENAVATVAEDdtdgdaRWEKIAELVE-GKTAEEVRRHYE 65
                                    *****************99****************.**********96 PP

2Myb_DNA-binding41.14.2e-13128172347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Zmw_sc08768.1.g00010.1.sm.mkhc 128 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 172
                                     7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.4651472IPR017884SANT domain
SMARTSM007174.1E-61570IPR001005SANT/Myb domain
SuperFamilySSF466892.08E-101874IPR009057Homeodomain-like
CDDcd001676.09E-71968No hitNo description
PfamPF002493.6E-71965IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-41965IPR009057Homeodomain-like
PROSITE profilePS5129417.671121177IPR017930Myb domain
SuperFamilySSF466891.2E-16123178IPR009057Homeodomain-like
SMARTSM007171.0E-11125175IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-17125175IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.5E-11126171IPR009057Homeodomain-like
PfamPF002491.2E-11128172IPR001005SANT/Myb domain
CDDcd001675.38E-9128173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAVEEATSSG EEGGGGAGWT REQEKAFENA VATVAEDDTD GDARWEKIAE LVEGKTAEEV  60
RRHYELLVED VDGIEAGRVP LPTYAGDDEG GGGSGGGWSG KKGSGGGGGG GEKGSAKSAE  120
QERRKGVAWT EDEHRLFLLG LEKYGKGDWR SISRNFVISR TPTQVASHAQ KYFIRLNSMN  180
RERRRQSIHD ITSVNNGDAS AAQGPITDWE EDDDCTSMVL MY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-171484673RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-104hypothetical protein SORBIDRAFT_06g032880
SwissprotQ8S9H73e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLC5YAI21e-104C5YAI2_SORBI; Putative uncharacterized protein Sb06g032880
STRINGSb06g032880.11e-103(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854